Lineage for d5ig0a_ (5ig0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544362Species Salpingoeca rosetta [TaxId:946362] [315168] (1 PDB entry)
  8. 2544363Domain d5ig0a_: 5ig0 A: [315169]
    automated match to d1hkxe_
    complexed with gol, so4

Details for d5ig0a_

PDB Entry: 5ig0 (more details), 1.75 Å

PDB Description: crystal structure of s. rosetta camkii hub
PDB Compounds: (A:) CAMK/CAMK2 protein kinase

SCOPe Domain Sequences for d5ig0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ig0a_ d.17.4.0 (A:) automated matches {Salpingoeca rosetta [TaxId: 946362]}
vpagpakavlevndellkavasgdwdayttmvdpnvtcfepeaagvlakglafhkfffdn
rspnadkmkttlhdpavqmfgdtaivtalrvvqfvaddgpkttryeetrvwvkdaafkfg
wklvhfhrsga

SCOPe Domain Coordinates for d5ig0a_:

Click to download the PDB-style file with coordinates for d5ig0a_.
(The format of our PDB-style files is described here.)

Timeline for d5ig0a_: