SCOPe 2.07: Domain d5in3a2: 5in3 A:198-366

Lineage for d5in3a2 (5in3 A:198-366)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries)

8. Domain d5in3a2: 5in3 A:198-366 [315094]
   automated match to d1guqa2
   complexed with edo, g1p, h2u, zn

Details for d5in3a2

PDB Entry: 5in3, 1.73 Å

PDB Description: crystal structure of glucose-1-phosphate bound nucleotidylated human galactose-1-phosphate uridylyltransferase

PDB Compounds: (A:) galactose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d5in3a2:

Sequence; same for both SEQRES and ATOM records:

>d5in3a2 d.13.1.2 (A:198-366) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
iaqreersqqayksqhgepllmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllp
rrhvrrlpeltpaerddlasimkklltkydnlfetsfpysmgwhgaptgseaganwnhwq
lhahyyppllrsatvrkfmvgyemlaqaqrdltpeqaaerlralpevhy

Timeline for d5in3a2:

• d5in3a2 first appeared in SCOPe 2.06
  
• d5in3a2 appears in the current release, SCOPe 2.08