| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
| Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
| Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries) |
| Domain d5in3a2: 5in3 A:198-366 [315094] automated match to d1guqa2 complexed with edo, g1p, h2u, zn |
PDB Entry: 5in3 (more details), 1.73 Å
SCOPe Domain Sequences for d5in3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in3a2 d.13.1.2 (A:198-366) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
iaqreersqqayksqhgepllmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllp
rrhvrrlpeltpaerddlasimkklltkydnlfetsfpysmgwhgaptgseaganwnhwq
lhahyyppllrsatvrkfmvgyemlaqaqrdltpeqaaerlralpevhy
Timeline for d5in3a2: