![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins) |
![]() | Protein Methylglyoxal synthase, MgsA [52340] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52341] (5 PDB entries) |
![]() | Domain d1b93b_: 1b93 B: [31508] CASP3 complexed with fmt, po4 |
PDB Entry: 1b93 (more details), 1.9 Å
SCOPe Domain Sequences for d1b93b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b93b_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv atadfiiqsphfndavdilipdyqryladrl
Timeline for d1b93b_: