Lineage for d1b93b_ (1b93 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22410Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein)
  6. 22411Protein Methylglyoxal synthase, MgsA [52340] (1 species)
  7. 22412Species Escherichia coli [TaxId:562] [52341] (2 PDB entries)
  8. 22414Domain d1b93b_: 1b93 B: [31508]

Details for d1b93b_

PDB Entry: 1b93 (more details), 1.9 Å

PDB Description: methylglyoxal synthase from escherichia coli

SCOP Domain Sequences for d1b93b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b93b_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

SCOP Domain Coordinates for d1b93b_:

Click to download the PDB-style file with coordinates for d1b93b_.
(The format of our PDB-style files is described here.)

Timeline for d1b93b_: