![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) ![]() |
![]() | Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52338] (7 PDB entries) |
![]() | Domain d1jdbh2: 1jdb H:936-1072 [31505] Other proteins in same PDB: d1jdbb1, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |
PDB Entry: 1jdb (more details), 2.1 Å
SCOP Domain Sequences for d1jdbh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdbh2 c.24.1.1 (H:936-1072) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli} stmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvhe grphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamalna datekvisvqemhaqik
Timeline for d1jdbh2:
![]() Domains from other chains: (mouse over for more information) d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |