Lineage for d1jdbl2 (1jdb L:153-380)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68686Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 68687Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins)
  6. 68698Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 68699Species Escherichia coli [TaxId:562] [52322] (7 PDB entries)
  8. 68727Domain d1jdbl2: 1jdb L:153-380 [31436]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1

Details for d1jdbl2

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbl2 c.23.16.1 (L:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1jdbl2:

Click to download the PDB-style file with coordinates for d1jdbl2.
(The format of our PDB-style files is described here.)

Timeline for d1jdbl2: