Lineage for d1jdbh2 (1jdb H:936-1072)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22379Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 22380Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 22381Species Escherichia coli [TaxId:562] [52338] (7 PDB entries)
  8. 22408Domain d1jdbh2: 1jdb H:936-1072 [31505]
    Other proteins in same PDB: d1jdbb1, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2

Details for d1jdbh2

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbh2 c.24.1.1 (H:936-1072) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
stmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvhe
grphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamalna
datekvisvqemhaqik

SCOP Domain Coordinates for d1jdbh2:

Click to download the PDB-style file with coordinates for d1jdbh2.
(The format of our PDB-style files is described here.)

Timeline for d1jdbh2: