Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Membrane fusion ATPase VCP/p97 [64038] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [313486] (5 PDB entries) |
Domain d5ftkc4: 5ftk C:471-763 [314625] Other proteins in same PDB: d5ftka1, d5ftka2, d5ftkb1, d5ftkb2, d5ftkc1, d5ftkc2, d5ftkd1, d5ftkd2, d5ftke1, d5ftke2, d5ftkf1, d5ftkf2 automated match to d3cf1a3 complexed with adp |
PDB Entry: 5ftk (more details), 2.4 Å
SCOPe Domain Sequences for d5ftkc4:
Sequence, based on SEQRES records: (download)
>d5ftkc4 c.37.1.20 (C:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]} vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirre rerqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq
>d5ftkc4 c.37.1.20 (C:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]} vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseivpe irrdhfeeamrfarrsvsdndirkyemfaqtlq
Timeline for d5ftkc4: