Lineage for d5ftkc4 (5ftk C:471-763)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451366Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2451573Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2451574Species Human (Homo sapiens) [TaxId:9606] [313486] (4 PDB entries)
  8. 2451593Domain d5ftkc4: 5ftk C:471-763 [314625]
    Other proteins in same PDB: d5ftka1, d5ftka2, d5ftkb1, d5ftkb2, d5ftkc1, d5ftkc2, d5ftkd1, d5ftkd2, d5ftke1, d5ftke2, d5ftkf1, d5ftkf2
    automated match to d3cf1a3
    complexed with adp

Details for d5ftkc4

PDB Entry: 5ftk (more details), 2.4 Å

PDB Description: cryo-em structure of human p97 bound to adp
PDB Compounds: (C:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftkc4:

Sequence, based on SEQRES records: (download)

>d5ftkc4 c.37.1.20 (C:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirre
rerqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq

Sequence, based on observed residues (ATOM records): (download)

>d5ftkc4 c.37.1.20 (C:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseivpe
irrdhfeeamrfarrsvsdndirkyemfaqtlq

SCOPe Domain Coordinates for d5ftkc4:

Click to download the PDB-style file with coordinates for d5ftkc4.
(The format of our PDB-style files is described here.)

Timeline for d5ftkc4: