Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries) |
Domain d5ftjc1: 5ftj C:21-106 [314600] Other proteins in same PDB: d5ftja2, d5ftja3, d5ftja4, d5ftjb2, d5ftjb3, d5ftjb4, d5ftjc2, d5ftjc3, d5ftjc4, d5ftjd2, d5ftjd3, d5ftjd4, d5ftje2, d5ftje3, d5ftje4, d5ftjf2, d5ftjf3, d5ftjf4 automated match to d3cf1a1 complexed with adp, oja |
PDB Entry: 5ftj (more details), 2.3 Å
SCOPe Domain Sequences for d5ftjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ftjc1 b.52.2.3 (C:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]} nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde kirmnrvvrnnlrvrlgdvisiqpcp
Timeline for d5ftjc1: