Lineage for d5fugh_ (5fug H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312123Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)
  8. 2312357Domain d5fugh_: 5fug H: [314547]
    automated match to d3afad_
    protein/DNA complex

Details for d5fugh_

PDB Entry: 5fug (more details), 2.7 Å

PDB Description: crystal structure of a human yl1-h2a.z-h2b complex
PDB Compounds: (H:) Histone H2B type 1-J

SCOPe Domain Sequences for d5fugh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fugh_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsrei
qtavrlllpgelakhavsegtkavtkyts

SCOPe Domain Coordinates for d5fugh_:

Click to download the PDB-style file with coordinates for d5fugh_.
(The format of our PDB-style files is described here.)

Timeline for d5fugh_: