SCOPe 2.08: Domain d5fsda_: 5fsd A:

Lineage for d5fsda_ (5fsd A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein automated matches [279671] (2 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [279673] (11 PDB entries)

8. Domain d5fsda_: 5fsd A: [314501]
   Other proteins in same PDB: d5fsdb_
   automated match to d5a6ta_
   complexed with dbx, edo, ni, oh, so4

Details for d5fsda_

PDB Entry: 5fsd, 1.75 Å

PDB Description: 1.75 a resolution 2,5-dihydroxybenzensulfonate inhibited sporosarcina pasteurii urease

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d5fsda_:

Sequence; same for both SEQRES and ATOM records:

>d5fsda_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d5fsda_:

• d5fsda_ first appeared in SCOPe 2.06
  
• d5fsda_ appears in SCOPe 2.07