![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein Urease, beta-subunit [51280] (4 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries) |
![]() | Domain d5fsdb_: 5fsd B: [314489] Other proteins in same PDB: d5fsda_ automated match to d1s3tb_ complexed with dbx, edo, ni, oh, so4 |
PDB Entry: 5fsd (more details), 1.75 Å
SCOPe Domain Sequences for d5fsdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fsdb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d5fsdb_: