Lineage for d5fgfx_ (5fgf X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2227648Domain d5fgfx_: 5fgf X: [314436]
    Other proteins in same PDB: d5fgfb_, d5fgfc_, d5fgfd_, d5fgfe_, d5fgff_, d5fgfg_, d5fgfh_, d5fgfk_, d5fgfm_, d5fgfp_, d5fgfq_, d5fgfr_, d5fgfs_, d5fgft_, d5fgfu_, d5fgfv_, d5fgfy_
    automated match to d1rypk_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5fgfx_

PDB Entry: 5fgf (more details), 2.6 Å

PDB Description: yeast 20s proteasome beta5-h(-2)a-t1a-k81r triple mutant in complex with carfilzomib
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d5fgfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fgfx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d5fgfx_:

Click to download the PDB-style file with coordinates for d5fgfx_.
(The format of our PDB-style files is described here.)

Timeline for d5fgfx_: