Lineage for d5fg7c_ (5fg7 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229456Domain d5fg7c_: 5fg7 C: [314302]
    Other proteins in same PDB: d5fg7a_, d5fg7e_, d5fg7g_, d5fg7i_, d5fg7j_, d5fg7k_, d5fg7l_, d5fg7n_, d5fg7o_, d5fg7s_, d5fg7u_, d5fg7w_, d5fg7x_, d5fg7y_, d5fg7z_
    automated match to d1rypd_
    complexed with cl, mg; mutant

Details for d5fg7c_

PDB Entry: 5fg7 (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta2-t1a mutant
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5fg7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fg7c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5fg7c_:

Click to download the PDB-style file with coordinates for d5fg7c_.
(The format of our PDB-style files is described here.)

Timeline for d5fg7c_: