Lineage for d4y6gb_ (4y6g B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157086Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2157109Species Salmonella typhimurium [TaxId:90371] [53689] (44 PDB entries)
  8. 2157131Domain d4y6gb_: 4y6g B: [314292]
    Other proteins in same PDB: d4y6ga_
    automated match to d1kfjb_
    complexed with f6f, na, plp

Details for d4y6gb_

PDB Entry: 4y6g (more details), 1.65 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium in complex with n-(4'-trifluoromethoxybenzoyl)-2-amino-1- ethylphosphate (f6f) inhibitor in the alpha-site and beta-site.
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4y6gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y6gb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkargei

SCOPe Domain Coordinates for d4y6gb_:

Click to download the PDB-style file with coordinates for d4y6gb_.
(The format of our PDB-style files is described here.)

Timeline for d4y6gb_: