Lineage for d1kfjb_ (1kfj B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) 
Protein Tryptophan synthase, beta-subunit [53688] (4 species) Species Salmonella typhimurium [TaxId:90371] [53689] (44 PDB entries) 
Domain d1kfjb_: 1kfj B: [90959]
Other proteins in same PDB: d1kfja_
complexed with na, pls
Details for d1kfjb_
PDB Entry: 1kfj (more details), 1.8 Å
PDB Description: crystal structure of wild-type tryptophan synthase complexed with l-serine
PDB Compounds: (B:) tryptophan synthase beta chainSCOPe Domain Sequences for d1kfjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg
SCOPe Domain Coordinates for d1kfjb_:
Click to download the PDB-style file with coordinates for d1kfjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kfjb_:
- d1kfjb_ first appeared in SCOP 1.67
- d1kfjb_ appears in SCOPe 2.05
- d1kfjb_ appears in SCOPe 2.07
- d1kfjb_ appears in the current release, SCOPe 2.08
View in 3D
