| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
| Domain d5fgdm_: 5fgd M: [314236] Other proteins in same PDB: d5fgda_, d5fgde_, d5fgdg_, d5fgdi_, d5fgdj_, d5fgdl_, d5fgdn_, d5fgdo_, d5fgds_, d5fgdu_, d5fgdw_, d5fgdx_, d5fgdz_ automated match to d4j70m_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 5fgd (more details), 2.8 Å
SCOPe Domain Sequences for d5fgdm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fgdm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d5fgdm_: