Lineage for d1c3of2 (1c3o F:153-380)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178184Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 178185Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
  6. 178196Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 178197Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)
  8. 178216Domain d1c3of2: 1c3o F:153-380 [31423]
    Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1

Details for d1c3of2

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3of2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3of2 c.23.16.1 (F:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgislgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1c3of2:

Click to download the PDB-style file with coordinates for d1c3of2.
(The format of our PDB-style files is described here.)

Timeline for d1c3of2: