Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) |
Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species) |
Species Escherichia coli [TaxId:562] [52451] (9 PDB entries) |
Domain d1c3og3: 1c3o G:1-127 [31687] Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2 |
PDB Entry: 1c3o (more details), 2.1 Å
SCOP Domain Sequences for d1c3og3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3og3 c.30.1.1 (G:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli} mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata daidkae
Timeline for d1c3og3:
View in 3D Domains from other chains: (mouse over for more information) d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3oh1, d1c3oh2 |