Lineage for d5d0sc_ (5d0s C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229177Domain d5d0sc_: 5d0s C: [314213]
    Other proteins in same PDB: d5d0sa_, d5d0se_, d5d0sg_, d5d0si_, d5d0sj_, d5d0sk_, d5d0sl_, d5d0sn_, d5d0so_, d5d0ss_, d5d0su_, d5d0sw_, d5d0sx_, d5d0sy_, d5d0sz_
    automated match to d1rypd_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5d0sc_

PDB Entry: 5d0s (more details), 2.5 Å

PDB Description: yeast 20s proteasome beta5-d166n mutant in complex with carfilzomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5d0sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0sc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5d0sc_:

Click to download the PDB-style file with coordinates for d5d0sc_.
(The format of our PDB-style files is described here.)

Timeline for d5d0sc_: