| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
| Domain d5cz8c_: 5cz8 C: [314158] Other proteins in same PDB: d5cz8a_, d5cz8e_, d5cz8g_, d5cz8i_, d5cz8j_, d5cz8l_, d5cz8n_, d5cz8o_, d5cz8s_, d5cz8u_, d5cz8w_, d5cz8x_, d5cz8z_ automated match to d1rypd_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 5cz8 (more details), 2.8 Å
SCOPe Domain Sequences for d5cz8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cz8c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5cz8c_: