Lineage for d1f8xa_ (1f8x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858402Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 2858403Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 2858404Species Lactobacillus leichmannii [TaxId:28039] [52312] (2 PDB entries)
  8. 2858407Domain d1f8xa_: 1f8x A: [31397]

Details for d1f8xa_

PDB Entry: 1f8x (more details), 2.5 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase
PDB Compounds: (A:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d1f8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8xa_ c.23.14.1 (A:) Nucleoside 2-deoxyribosyltransferase {Lactobacillus leichmannii [TaxId: 28039]}
pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy

SCOPe Domain Coordinates for d1f8xa_:

Click to download the PDB-style file with coordinates for d1f8xa_.
(The format of our PDB-style files is described here.)

Timeline for d1f8xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f8xb_