PDB entry 1f8x

View 1f8x on RCSB PDB site
Description: crystal structure of nucleoside 2-deoxyribosyltransferase
Class: transferase
Keywords: active site, alpha/beta protein, biocatalyst, nucleoside, x-ray crystallography, TRANSFERASE
Deposited on 2000-07-05, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Lactobacillus leichmannii [TaxId:28039]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f8xa_
  • Chain 'B':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Lactobacillus leichmannii [TaxId:28039]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f8xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8xA (A:)
    mpkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylh
    dkvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygk
    pinlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8xA (A:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8xB (B:)
    mpkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylh
    dkvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygk
    pinlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8xB (B:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy