Lineage for d5f32b_ (5f32 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815818Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
    Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)
  6. 2815826Protein JMJD2A core [254342] (1 species)
  7. 2815827Species Human (Homo sapiens) [TaxId:9606] [254775] (57 PDB entries)
  8. 2815845Domain d5f32b_: 5f32 B: [313933]
    automated match to d4v2wb_
    complexed with 5v7, dms, edo, gol, zn

Details for d5f32b_

PDB Entry: 5f32 (more details), 2.05 Å

PDB Description: crystal structure of human kdm4a in complex with compound 40
PDB Compounds: (B:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5f32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f32b_ b.82.2.14 (B:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
sarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipap
iqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnpp
iygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawhte
dmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplml
kkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrk
dmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl

SCOPe Domain Coordinates for d5f32b_:

Click to download the PDB-style file with coordinates for d5f32b_.
(The format of our PDB-style files is described here.)

Timeline for d5f32b_: