Lineage for d5ehnb_ (5ehn B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507027Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2507028Protein Acetylcholinesterase [53476] (6 species)
  7. 2507072Species Mouse (Mus musculus) [TaxId:10090] [53479] (43 PDB entries)
  8. 2507144Domain d5ehnb_: 5ehn B: [313719]
    automated match to d1j07a_
    complexed with 5nz, nag, p6g

Details for d5ehnb_

PDB Entry: 5ehn (more details), 2.6 Å

PDB Description: mache-syn tz2pa5 complex
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d5ehnb_:

Sequence, based on SEQRES records: (download)

>d5ehnb_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

Sequence, based on observed residues (ATOM records): (download)

>d5ehnb_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
ndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

SCOPe Domain Coordinates for d5ehnb_:

Click to download the PDB-style file with coordinates for d5ehnb_.
(The format of our PDB-style files is described here.)

Timeline for d5ehnb_: