Lineage for d5e4ab_ (5e4a B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2378754Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2379492Protein automated matches [190376] (1 species)
    not a true protein
  7. 2379493Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)
  8. 2379497Domain d5e4ab_: 5e4a B: [313561]
    automated match to d1ttaa_
    complexed with 5jw

Details for d5e4ab_

PDB Entry: 5e4a (more details), 1.33 Å

PDB Description: human transthyretin (ttr) complexed with (2,7-dichloro-fluoren-9- ylideneaminooxy)-acetic acid.
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5e4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4ab_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d5e4ab_:

Click to download the PDB-style file with coordinates for d5e4ab_.
(The format of our PDB-style files is described here.)

Timeline for d5e4ab_: