SCOPe 2.07: Domain d5e4aa_: 5e4a A:

Lineage for d5e4aa_ (5e4a A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)

8. Domain d5e4aa_: 5e4a A: [313538]
   automated match to d1ttaa_
   complexed with 5jw

Details for d5e4aa_

PDB Entry: 5e4a, 1.33 Å

PDB Description: human transthyretin (ttr) complexed with (2,7-dichloro-fluoren-9- ylideneaminooxy)-acetic acid.

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d5e4aa_:

Sequence; same for both SEQRES and ATOM records:

>d5e4aa_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d5e4aa_:

• d5e4aa_ first appeared in SCOPe 2.06
  
• d5e4aa_ appears in the current release, SCOPe 2.08