Lineage for d5dtwa1 (5dtw A:1-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854044Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries)
  8. 2854086Domain d5dtwa1: 5dtw A:1-243 [313476]
    Other proteins in same PDB: d5dtwa2, d5dtwb2, d5dtwc2, d5dtwd2, d5dtwe2, d5dtwf2
    automated match to d3he2a_
    complexed with 5f9

Details for d5dtwa1

PDB Entry: 5dtw (more details), 2.44 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to c20-coa
PDB Compounds: (A:) enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5dtwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dtwa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

SCOPe Domain Coordinates for d5dtwa1:

Click to download the PDB-style file with coordinates for d5dtwa1.
(The format of our PDB-style files is described here.)

Timeline for d5dtwa1: