Lineage for d5dtwe1 (5dtw E:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (57 species)
    not a true protein
  7. 2437027Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)
  8. 2437091Domain d5dtwe1: 5dtw E:1-243 [313554]
    Other proteins in same PDB: d5dtwa2, d5dtwb2, d5dtwc2, d5dtwd2, d5dtwe2, d5dtwf2
    automated match to d3he2a_
    complexed with 5f9

Details for d5dtwe1

PDB Entry: 5dtw (more details), 2.44 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to c20-coa
PDB Compounds: (E:) enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5dtwe1:

Sequence, based on SEQRES records: (download)

>d5dtwe1 c.14.1.0 (E:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

Sequence, based on observed residues (ATOM records): (download)

>d5dtwe1 c.14.1.0 (E:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfptsk
yglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaaeia
rlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqga

SCOPe Domain Coordinates for d5dtwe1:

Click to download the PDB-style file with coordinates for d5dtwe1.
(The format of our PDB-style files is described here.)

Timeline for d5dtwe1: