![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries) |
![]() | Domain d5dtpc1: 5dtp C:1-243 [313445] Other proteins in same PDB: d5dtpa2, d5dtpb2, d5dtpc2 automated match to d3he2a_ |
PDB Entry: 5dtp (more details), 1.91 Å
SCOPe Domain Sequences for d5dtpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dtpc1 c.14.1.0 (C:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf qga
Timeline for d5dtpc1:
![]() Domains from other chains: (mouse over for more information) d5dtpa1, d5dtpa2, d5dtpb1, d5dtpb2 |