SCOPe 2.06: Domain d5dtpc1: 5dtp C:1-243

Lineage for d5dtpc1 (5dtp C:1-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)

8. Domain d5dtpc1: 5dtp C:1-243 [313445]
   Other proteins in same PDB: d5dtpa2, d5dtpb2, d5dtpc2
   automated match to d3he2a_

Details for d5dtpc1

PDB Entry: 5dtp, 1.91 Å

PDB Description: crystal structure of m. tuberculosis echa6 (apo, trigonal crystal form)

PDB Compounds: (C:) Probable enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5dtpc1:

Sequence; same for both SEQRES and ATOM records:

>d5dtpc1 c.14.1.0 (C:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

Timeline for d5dtpc1:

• d5dtpc1 is new in SCOPe 2.06-stable
  
• d5dtpc1 appears in SCOPe 2.07
  
• d5dtpc1 appears in the current release, SCOPe 2.08