SCOPe 2.08: Domain d5dp4d1: 5dp4 D:1-180

Lineage for d5dp4d1 (5dp4 D:1-180)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same fold
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
Protein automated matches [190384] (21 species)
not a true protein
Species Enterovirus a71 [TaxId:39054] [279546] (12 PDB entries)
Domain d5dp4d1: 5dp4 D:1-180 [313440]
Other proteins in same PDB: d5dp4a2, d5dp4b2, d5dp4c2, d5dp4d2
automated match to d2vb0a_
complexed with 5e8

Details for d5dp4d1

PDB Entry: 5dp4 (more details), 2.21 Å

PDB Description: crystal structure of ev71 3c proteinase in complex with compound 3

PDB Compounds: (D:) 3C proteinase

SCOPe Domain Sequences for d5dp4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dp4d1 b.47.1.4 (D:1-180) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnildav
elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfa

SCOPe Domain Coordinates for d5dp4d1:

Click to download the PDB-style file with coordinates for d5dp4d1.
(The format of our PDB-style files is described here.)

Timeline for d5dp4d1: