Lineage for d5d9za_ (5d9z A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422814Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2422815Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2422867Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 2422868Protein automated matches [190587] (7 species)
    not a true protein
  7. 2422869Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries)
  8. 2422898Domain d5d9za_: 5d9z A: [313347]
    automated match to d5d5ga_
    complexed with bma, po4

Details for d5d9za_

PDB Entry: 5d9z (more details), 1.85 Å

PDB Description: structure of colocasia esculenta agglutinin with mannose bound
PDB Compounds: (A:) Tuber agglutinin

SCOPe Domain Sequences for d5d9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d9za_ b.78.1.0 (A:) automated matches {Colocasia esculenta [TaxId: 4460]}
lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg

SCOPe Domain Coordinates for d5d9za_:

Click to download the PDB-style file with coordinates for d5d9za_.
(The format of our PDB-style files is described here.)

Timeline for d5d9za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5d9zb_