PDB entry 5d9z

View 5d9z on RCSB PDB site
Description: Structure of Colocasia Esculenta Agglutinin with mannose bound
Class: sugar binding protein
Keywords: lectin, protein-carbohydrate interactions, dietary protein, beta prism II fold, 18-aug, sugar binding protein
Deposited on 2015-08-19, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9za_
  • Chain 'B':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9zb_
  • Heterogens: BMA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d9zA (A:)
    lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
    lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d9zB (B:)
    nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspqa