SCOPe 2.08: Domain d5d2ca_: 5d2c A:

Lineage for d5d2ca_ (5d2c A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [313252] (3 PDB entries)

8. Domain d5d2ca_: 5d2c A: [313342]
   automated match to d3ffwa_
   complexed with bef, gol, imd, mn, so4

Details for d5d2ca_

PDB Entry: 5d2c, 2.06 Å

PDB Description: reaction of phosphorylated chey with imidazole 1 of 3

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d5d2ca_:

Sequence; same for both SEQRES and ATOM records:

>d5d2ca_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d5d2ca_:

• d5d2ca_ first appeared in SCOPe 2.06
  
• d5d2ca_ appears in SCOPe 2.07