PDB entry 5d2c
View 5d2c on RCSB PDB site
Description: Reaction of phosphorylated CheY with imidazole 1 of 3
Class: metal binding protein
Keywords: two component signaling, asp to his phosphotransfer, response regulator, receiver domain, METAL BINDING PROTEIN
Deposited on
2015-08-05, released
2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-25, with a file datestamp of
2019-12-20.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chemotaxis protein cheY
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: cheY, Z2936, ECs2592
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE68 (0-127)
- engineered mutation (12)
- engineered mutation (57)
- engineered mutation (87)
Domains in SCOPe 2.08: d5d2ca_ - Chain 'B':
Compound: Chemotaxis protein cheY
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: cheY, Z2936, ECs2592
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE68 (0-127)
- engineered mutation (12)
- engineered mutation (57)
- engineered mutation (87)
Domains in SCOPe 2.08: d5d2cb_ - Heterogens: MN, BEF, IMD, GOL, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5d2cA (A:)
adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5d2cB (B:)
adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm