Lineage for d5d0xs_ (5d0x S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225800Domain d5d0xs_: 5d0x S: [313272]
    Other proteins in same PDB: d5d0xa_, d5d0xb_, d5d0xc_, d5d0xd_, d5d0xf_, d5d0xh_, d5d0xi_, d5d0xj_, d5d0xl_, d5d0xm_, d5d0xn_, d5d0xo_, d5d0xp_, d5d0xq_, d5d0xr_, d5d0xt_, d5d0xv_, d5d0xw_, d5d0xx_, d5d0xz_
    automated match to d4g4sf_

Details for d5d0xs_

PDB Entry: 5d0x (more details), 2.6 Å

PDB Description: yeast 20s proteasome beta5-t1s mutant in complex with bortezomib
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5d0xs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0xs_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5d0xs_:

Click to download the PDB-style file with coordinates for d5d0xs_.
(The format of our PDB-style files is described here.)

Timeline for d5d0xs_: