| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
| Domain d5d0vv_: 5d0v V: [313211] Other proteins in same PDB: d5d0va_, d5d0ve_, d5d0vg_, d5d0vi_, d5d0vj_, d5d0vl_, d5d0vn_, d5d0vo_, d5d0vs_, d5d0vu_, d5d0vw_, d5d0vx_, d5d0vz_ automated match to d4r17h_ |
PDB Entry: 5d0v (more details), 2.9 Å
SCOPe Domain Sequences for d5d0vv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d0vv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d5d0vv_: