Lineage for d5cz7y_ (5cz7 Y:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229159Domain d5cz7y_: 5cz7 Y: [313112]
    Other proteins in same PDB: d5cz7a_, d5cz7e_, d5cz7g_, d5cz7i_, d5cz7j_, d5cz7l_, d5cz7n_, d5cz7o_, d5cz7s_, d5cz7u_, d5cz7w_, d5cz7x_, d5cz7z_
    automated match to d4g4sl_
    complexed with bo2, cl, mg; mutant

Details for d5cz7y_

PDB Entry: 5cz7 (more details), 2.5 Å

PDB Description: yeast 20s proteasome beta5-t1a beta5-k81r double mutant in complex with bortezomib, propeptide expressed in cis
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d5cz7y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cz7y_ d.153.1.4 (Y:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kiahgattlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfw
etwlgsqcrlhelrekerisvaaasrilsnlvyqykgaglsmgtmicgytrkegptiyyv
dsdgtrlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsv
nlyhvtedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d5cz7y_:

Click to download the PDB-style file with coordinates for d5cz7y_.
(The format of our PDB-style files is described here.)

Timeline for d5cz7y_: