Lineage for d5aalb_ (5aal B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767692Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries)
  8. 2767708Domain d5aalb_: 5aal B: [313088]
    automated match to d4csta_
    complexed with 8l8, ni, so4

Details for d5aalb_

PDB Entry: 5aal (more details), 2.45 Å

PDB Description: complex of the fimh lectin with a c-linked para-biphenyl ethylene alpha-d-mannoside in soaked trigonal crystals at 2.45 a resolution
PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d5aalb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aalb_ b.2.3.2 (B:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5aalb_:

Click to download the PDB-style file with coordinates for d5aalb_.
(The format of our PDB-style files is described here.)

Timeline for d5aalb_: