Lineage for d4csta_ (4cst A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767692Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries)
  8. 2767694Domain d4csta_: 4cst A: [269239]
    automated match to d3zl2a_
    complexed with cwk

Details for d4csta_

PDB Entry: 4cst (more details), 1.1 Å

PDB Description: crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d- mannopyranosyloxy)-biphenyl-4-carbonitrile
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d4csta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4csta_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptg

SCOPe Domain Coordinates for d4csta_:

Click to download the PDB-style file with coordinates for d4csta_.
(The format of our PDB-style files is described here.)

Timeline for d4csta_: