Lineage for d4yvua1 (4yvu A:2-182)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044451Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2044492Species Bacillus subtilis [TaxId:224308] [271928] (4 PDB entries)
  8. 2044502Domain d4yvua1: 4yvu A:2-182 [313063]
    automated match to d3zdwa1
    complexed with cu, edo, gol

Details for d4yvua1

PDB Entry: 4yvu (more details), 2.3 Å

PDB Description: crystal structure of cota native enzyme in the acid condition, ph5.6
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4yvua1:

Sequence, based on SEQRES records: (download)

>d4yvua1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d4yvua1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhheepevktvvhlhggvtpddsdgypeawfsk
dfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d4yvua1:

Click to download the PDB-style file with coordinates for d4yvua1.
(The format of our PDB-style files is described here.)

Timeline for d4yvua1: