Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Spore coat protein A, CotA [89219] (2 species) |
Species Bacillus subtilis [TaxId:224308] [271928] (4 PDB entries) |
Domain d4yvua3: 4yvu A:357-511 [313065] automated match to d3zdwa3 complexed with cu, edo, gol |
PDB Entry: 4yvu (more details), 2.3 Å
SCOPe Domain Sequences for d4yvua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yvua3 b.6.1.3 (A:357-511) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]} sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr iaatfgpysgryvwhchilehedydmmrpmditdp
Timeline for d4yvua3: