SCOPe 2.07: Domain d5c6ca_: 5c6c A:

Lineage for d5c6ca_ (5c6c A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)

8. Domain d5c6ca_: 5c6c A: [312844]
   automated match to d4offa_
   complexed with ca, cd, cmp, co, edo, na

Details for d5c6ca_

PDB Entry: 5c6c, 2.05 Å

PDB Description: pkg ii's amino terminal cyclic nucleotide binding domain (cnb-a) in a complex with camp

PDB Compounds: (A:) cGMP-dependent protein kinase 2

SCOPe Domain Sequences for d5c6ca_:

Sequence; same for both SEQRES and ATOM records:

>d5c6ca_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvla
egrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr

Timeline for d5c6ca_:

• d5c6ca_ first appeared in SCOPe 2.06
  
• d5c6ca_ appears in the current release, SCOPe 2.08