Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries) |
Domain d5c6ca_: 5c6c A: [312844] automated match to d4offa_ complexed with ca, cd, cmp, co, edo, na |
PDB Entry: 5c6c (more details), 2.05 Å
SCOPe Domain Sequences for d5c6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c6ca_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvla egrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr
Timeline for d5c6ca_: