SCOPe 2.07: Domain d5c0tb2: 5c0t B:81-208

Lineage for d5c0tb2 (5c0t B:81-208)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.2: MerB-like [160391] (1 protein)
   Pfam PF03243

6. Protein Alkylmercury lyase MerB [160392] (1 species)

7. Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
   Uniprot P77072 81-212

8. Domain d5c0tb2: 5c0t B:81-208 [312837]
   Other proteins in same PDB: d5c0ta1, d5c0tb1
   automated match to d3f2ga2
   complexed with br, hg; mutant

Details for d5c0tb2

PDB Entry: 5c0t, 1.96 Å

PDB Description: crystal structure of the mercury-bound form of merb mutant d99s

PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5c0tb2:

Sequence; same for both SEQRES and ATOM records:

>d5c0tb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcalstlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

Timeline for d5c0tb2:

• d5c0tb2 first appeared in SCOPe 2.06
  
• d5c0tb2 appears in the current release, SCOPe 2.08