| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.357: NosL/MerB-like [160386] (1 superfamily) unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication |
Superfamily d.357.1: NosL/MerB-like [160387] (2 families) ![]() |
| Family d.357.1.2: MerB-like [160391] (1 protein) Pfam PF03243 |
| Protein Alkylmercury lyase MerB [160392] (1 species) |
| Species Escherichia coli [TaxId:562] [160393] (17 PDB entries) Uniprot P77072 81-212 |
| Domain d5c0tb2: 5c0t B:81-208 [312837] Other proteins in same PDB: d5c0ta1, d5c0tb1 automated match to d3f2ga2 complexed with br, hg; mutant |
PDB Entry: 5c0t (more details), 1.96 Å
SCOPe Domain Sequences for d5c0tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c0tb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcalstlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms
Timeline for d5c0tb2: