| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
| Protein automated matches [226904] (39 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries) |
| Domain d5bpfb2: 5bpf B:97-306 [312614] Other proteins in same PDB: d5bpfa1, d5bpfb1, d5bpfc1, d5bpfd1 automated match to d1iova2 complexed with act, adp, gol, na |
PDB Entry: 5bpf (more details), 2.28 Å
SCOPe Domain Sequences for d5bpfb2:
Sequence, based on SEQRES records: (download)
>d5bpfb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad
>d5bpfb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshsvgmskvdh
aselqkalveafqdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaklsdkt
qyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshs
lvpmaarqyglsfsqlvarilmlad
Timeline for d5bpfb2: