Lineage for d1iova2 (1iov A:97-306)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) 
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins) 
Protein D-ala-D-ala ligase, C-domain [56063] (1 species) Species Escherichia coli, gene ddlB [TaxId:562] [56064] (3 PDB entries) 
Domain d1iova2: 1iov A:97-306 [41482]
Other proteins in same PDB: d1iova1
complexed with adp, mg, pob
Details for d1iova2
PDB Entry: 1iov (more details), 2.2 Å
PDB Description: complex of d-ala:d-ala ligase with adp and a phosphoryl phosphonate
PDB Compounds: (A:) d-ala:d-ala ligaseSCOPe Domain Sequences for d1iova2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iova2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]}
klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk
vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky
lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg
mtshslvpmaarqagmsfsqlvvrilelad
SCOPe Domain Coordinates for d1iova2:
Click to download the PDB-style file with coordinates for d1iova2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iova2:
- d1iova2 first appeared (with stable ids) in SCOP 1.55, called d1iov_2
- d1iova2 appears in SCOPe 2.07
View in 3D
